• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TSG101 Antibody

TSG101 Antibody (R32315)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32315 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat heart, 2) rat brain, 3) human HeLa and 4) human SMMC lysate with TSG101 antibody. Expected/observed molecular weight ~45 kDa.
Western blot testing of 1) rat heart, 2) rat brain, 3) human HeLa and 4) human SMMC lysate with TSG101 antibody. Expected/observed molecular weight ~45 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q99816
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Limitations This TSG101 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
  • Applications : WB, IHC, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Human, Mouse, Rat

Description

TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.

Application Notes

Optimal dilution of the TSG101 antibody should be determined by the researcher.

Immunogen

Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody.

Storage

After reconstitution, the TSG101 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TSG101 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.