• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> TRIF Antibody / TICAM1

TRIF Antibody / TICAM1 (R32274)

  Catalog No Formulation Size Price (USD)  
Image R32274 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of mouse 1) brain, 2) spleen, 3) testis, and 4) liver lysate with TRIF antibody. Predicted molecular weight: 76 kDa but routinely observed at 70-150 kDa.
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q80UF7
Applications Western Blot : 0.1-0.5ug/ml
Limitations This TRIF antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IHC-F
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow, Dog, Mouse, Pig, Rat
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Human

Description

TICAM1 (TIR domain containing adaptor molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.

Application Notes

Optimal dilution of the TRIF antibody should be determined by the researcher.

Immunogen

Amino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody.

Storage

After reconstitution, the TRIF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.