• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Transferrin Antibody / TF

Transferrin Antibody / TF [clone 7I11B10] (RQ7657)

  Catalog No Formulation Size Price (USD)  
Image RQ7657 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) human HCCP, 2) rat liver and 3) mouse liver tissue lysate with Transferrin antibody. Predicted molecular weight ~77 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 7I11B10
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P02787
Applications Western Blot : 0.5-1ug/ml
Limitations This Transferrin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M?1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

Application Notes

Optimal dilution of the Transferrin antibody should be determined by the researcher.

Immunogen

Amino acids 20-49 (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) from the human protein were used as the immunogen for the Transferrin antibody.

Storage

After reconstitution, the Transferrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.