• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Transferrin Antibody

Transferrin Antibody (R31874)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31874 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE human esophageal cancer tissue with Transferrin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human esophageal cancer tissue with Transferrin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human placenta, 2) human HCCT, 3) human HCCP, 4) human HepG2, 5) rat liver, 6) mouse liver and 7) mouse HEPA1-6 cell lysate with Transferrin antibody. Expected molecular weight ~77 kDa.
Flow cytometry testing of fixed and permeabilized human HepG2 cells with Transferrin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Transferrin antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P02787
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Transferrin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly.

Application Notes

Optimal dilution of the Transferrin antibody should be determined by the researcher.

Immunogen

Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.

Storage

After reconstitution, the Transferrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Transferrin antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.