• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> TNF alpha Antibody

TNF alpha Antibody (R32668)

  Catalog No Formulation Size Price (USD)  
Image R32668 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of mouse thymus tissue with TNF alpha antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P06804
Applications Western Blot : 0.5-1ug/ml
Limitations This TNF alpha antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

TNFa (Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Application Notes

Optimal dilution of the TNF alpha antibody should be determined by the researcher.

Immunogen

Amino acids 202-235 (FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL) from the mouse protein were used as the immunogen for the TNF alpha antibody.

Storage

After reconstitution, the TNF alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.