- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Tumor Necrosis Factor alpha is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It binds and functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation and has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
The stated application concentrations are suggested starting points. Titration of the TNF alpha antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Amino acids 201-233 (QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL) were used as the immunogen for this TNF alpha antibody.
After reconstitution, the TNF alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.