• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TMEM166 Antibody / EVA1A

TMEM166 Antibody / EVA1A (RQ4951)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4951 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HepG2 and 2) PC-3 lysate with TMEM166 antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
›
Western blot testing of human 1) HepG2 and 2) PC-3 lysate with TMEM166 antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
IHC staining of FFPE human liver cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human renal cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Flow cytometry testing of human A549 cells with TMEM166 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM166 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9H8M9
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This TMEM166 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Application Notes

Optimal dilution of the TMEM166 antibody should be determined by the researcher.

Immunogen

Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.

Storage

After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TMEM166 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.