- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
TGFBR1 Antibody (R32084)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32084 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| UniProt | P36897 |
| Applications | Western blot : 0.1-0.5ug/ml |
| Limitations | This TGFBR1 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.
Optimal dilution of the TGFBR1 antibody should be determined by the researcher.
Amino acids HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT of human TGFBR1 were used as the immunogen for the TGFBR1 antibody.
After reconstitution, the TGFBR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz