• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TGF beta Receptor II Antibody

TGF beta Receptor II Antibody (R32086)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32086 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) MCF7, 2) SW620, 3) 22RV1 and 4) HeLa cell lysate with TGF beta Receptor II antibody. Expected molecular weight ~65 kDa, routinely observed at 65-80 kDa.
Western blot testing of human 1) MCF7, 2) SW620, 3) 22RV1 and 4) HeLa cell lysate with TGF beta Receptor II antibody. Expected molecular weight ~65 kDa, routinely observed at 65-80 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P37173
Applications Western blot : 0.1-0.5ug/ml
Limitations This TGF beta Receptor II antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.

Application Notes

Optimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.

Immunogen

Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.

Storage

After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TGFBR2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.