• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> TGF beta receptor I Antibody

TGF beta receptor I Antibody (R32569)

  Catalog No Formulation Size Price (USD)  
Image R32569 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat heart, 2) mouse liver and 3) human HeLa lysate with TGF beta receptor I antibody at 0.5ug/ml. Predicted/observed molecular weight ~55 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P36897
Applications Western Blot : 0.5-1ug/ml
Limitations This TGF beta receptor I antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the TGF beta receptor I antibody to be titrated for optimal performance.

Immunogen

Amino acids 149-186 (HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT from the human protein were used as the immunogen for the TGF beta receptor I antibody.

Storage

After reconstitution, the TGF beta receptor I antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.