- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.
Optimal dilution of the TCF-8 antibody should be determined by the researcher.
Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody.
After reconstitution, the TCF-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.