- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.
Optimal dilution of the SUR1 antibody should be determined by the researcher.
Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody.
After reconstitution, the SUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.