• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SUMO1 Antibody

SUMO1 Antibody (RQ6212)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6212 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE human breast cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human breast cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with SUMO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HL60 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.
Flow cytometry testing of human HEPA1-6 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.0125% sodium azide
UniProt P63165
Localization Predominantly nuclear with some cytoplasmic
Applications Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This SUMO1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human, Rat
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human, Rat
  • Applications : WB, IHC-P, IF
    Reactivity : Human, Rat
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
  • Applications : IHC, IF, WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig

Description

Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

Application Notes

Optimal dilution of the SUMO1 antibody should be determined by the researcher.

Immunogen

Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

Storage

After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SUMO1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.