• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> STXBP2 Antibody / UNC18-2

STXBP2 Antibody / UNC18-2 (R32239)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32239 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human SK-OC-3 cells with STXBP2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human SK-OC-3 cells with STXBP2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U937 cells with STXBP2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= STXBP2 antibody.
Western blot testing of 1) rat brain, 2) mouse brain, 3) human HepG2 and 4) human HeLa lysate with STXBP2 antibody. Expected molecular weight ~66 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q15833
Applications Western blot : 0.1-0.5ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This STXBP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Application Notes

Optimal dilution of the STXBP2 antibody should be determined by the researcher.

Immunogen

Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.

Storage

After reconstitution, the STXBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all STXBP2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.