- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Stimulator of interferon genes protein (STING1), also known as TMEM173, is an intracellular adaptor protein that plays a central role in cytosolic DNA sensing and innate immune signaling. STING Antibody for FACS enables detection of STING1 expression in individual cells using flow cytometry, supporting quantitative analysis of innate immune signaling pathways within heterogeneous cell populations. Flow cytometry provides a powerful platform for analyzing protein expression at the single-cell level, allowing researchers to identify STING-positive cell populations and examine variation in signaling protein expression across immune cell subsets.
STING1 functions as a key mediator of the cyclic GMP-AMP synthase (cGAS)-STING signaling pathway. In this pathway, cGAS detects cytosolic DNA derived from viral infection, bacterial pathogens, or damaged host cells and produces the cyclic dinucleotide cGAMP. Binding of cGAMP activates STING, which then recruits downstream signaling molecules including TBK1 and IRF3 to initiate transcription of type I interferons and inflammatory cytokines. Because of its central role in innate immune activation, detection of STING1 expression is frequently used to investigate immune signaling responses and activation states in immune cell populations.
Flow cytometric detection of STING1 allows researchers to analyze intracellular expression patterns within immune cells such as macrophages, dendritic cells, monocytes, and lymphocytes. Cells can be fixed and permeabilized to permit antibody access to intracellular proteins, enabling measurement of STING1 levels within the cytoplasm where the protein normally resides. Quantitative fluorescence measurements obtained by flow cytometry allow comparison of STING1 expression across cell types or experimental conditions, providing insight into activation of innate immune pathways.
A rabbit polyclonal antibody recognizing STING1 supports flow cytometry studies examining innate immune signaling and immune cell phenotypes. Detection of STING-positive cells by flow cytometry enables researchers to evaluate immune pathway activation, characterize immune cell subsets, and investigate regulation of interferon-mediated responses in experimental systems.
Optimal dilution of the STING Antibody for FACS should be determined by the researcher.
Amino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING were used as the immunogen for the STING antibody.
After reconstitution, the STING antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
STING1 antibody, TMEM173 antibody, Stimulator of interferon genes protein antibody, Transmembrane protein 173 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.