• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> STAT1 Antibody

STAT1 Antibody (R32095)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32095 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of rat 1) testis, 2) brain, 3) liver, and human 4) placenta, 5) MCF7, and 6) SW620 lysate with STAT1 antibody. Predicted/observed molecular weight: ~91/84 kDa (alpha/beta).
›
Western blot testing of rat 1) testis, 2) brain, 3) liver, and human 4) placenta, 5) MCF7, and 6) SW620 lysate with STAT1 antibody. Predicted/observed molecular weight: ~91/84 kDa (alpha/beta).
IHC testing of FFPE human breast cancer with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P42224
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This STAT1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, IHC-P, IF/ICC, FACS
    Reactivity : Human, Mouse, Rat, Monkey

Description

The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1 (STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.

Application Notes

Optimal dilution of the STAT1 antibody should be determined by the researcher.

Immunogen

Amino acids KILENAQRFNQAQSGNIQSTVMLDKQKELD of human STAT1 were used as the immunogen for the STAT1 antibody.

Storage

After reconstitution, the STAT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all STAT1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.