• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> StAR Antibody / Steroidogenic acute regulatory protein

StAR Antibody / Steroidogenic acute regulatory protein (RQ4391)

  Catalog No Formulation Size Price (USD)  
Image RQ4391 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat testis and 2) mouse testis lysate with StAR antibody at 0.5ug/ml. Expected molecular weight ~37 kDa (preprotein), ~30 kDa (mature form).
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P49675
Applications Western Blot : 0.5-1ug/ml
Limitations This StAR antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

Application Notes

Optimal dilution of the StAR antibody should be determined by the researcher.

Immunogen

Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.

Storage

After reconstitution, the StAR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.