• Tel: 858.663.9055
  • Email: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SRY Antibody / Sex-Determining Region Y (Middle Region)

SRY Antibody / Sex-Determining Region Y (Middle Region) (R32850)

  Catalog No Formulation Size Price (USD)  
R32850 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of human HeLa cell lysate with SRY antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q05066
Applications Western Blot : 0.5-1ug/ml
Limitations This SRY antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF) or Sex-determining region Y (SRY), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Application Notes

Optimal dilution of the SRY antibody should be determined by the researcher.

Immunogen

Amino acids 90-130 (ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) were used as the immunogen for the SRY antibody.

Storage

After reconstitution, the SRY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code:


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.