• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SMC3 Antibody

SMC3 Antibody [clone 4C12] (RQ4493)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4493 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) A549, 3) MCF7 and 4) MDA-MB-453 lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
›
Western blot testing of human 1) HeLa, 2) A549, 3) MCF7 and 4) MDA-MB-453 lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
IHC testing of FFPE human lung cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human intestinal cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) human HeLa, 2) human HEK293, 3) rat thymus and 4) mouse thymus lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 4C12
Purity Protein G affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9UQE7
Localization Nucleus
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This SMC3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Application Notes

Optimal dilution of the SMC3 antibody should be determined by the researcher.

Immunogen

Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH were used as the immunogen for the SMC3 antibody.

Storage

After reconstitution, the SMC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SMC3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.