• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SMAD1/5 Antibody

SMAD1/5 Antibody (RQ4044)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4044 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney, 2) rat testis, 3) mouse brain, 4) mouse kidney, 5) mouse testis, 6) human HeLa, 7) human A375 and 8) human HepG2 lysate with SMAD1/5 antibody at 0.5ug/ml. Expected molecular weight: 52-60 kDa.
Western blot testing of 1) rat kidney, 2) rat testis, 3) mouse brain, 4) mouse kidney, 5) mouse testis, 6) human HeLa, 7) human A375 and 8) human HepG2 lysate with SMAD1/5 antibody at 0.5ug/ml. Expected molecular weight: 52-60 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q15797
Applications Western Blot : 0.5-1ug/ml
Limitations This SMAD1/5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IF
    Reactivity : Human
  • Applications : WB, IHC-P, ICC
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Chicken, Zebrafish
  • Applications : IHC, IF, WB, ELISA
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Bovine
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine
  • Applications : WB, ELISA
    Reactivity : Rat
    Pred. Reactivity : Bovine, Chicken, Mouse, Zebrafish
  • Applications : WB, ELISA
    Reactivity : Mouse
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, IHC-P, IF
    Reactivity : Human, Mouse, Rat

Description

SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-? superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.

Application Notes

Optimal dilution of the SMAD1/5 antibody should be determined by the researcher.

Immunogen

Amino acids KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK from the human protein were used as the immunogen for the SMAD1/5 antibody.

Storage

After reconstitution, the SMAD1/5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SMAD1/5 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.