• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SLC7A3 Antibody / CAT-3 (N-Terminal)

SLC7A3 Antibody / CAT-3 (N-Terminal) (R32985)

  Catalog No Formulation Size Price (USD)  
Image R32985 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human A431 cell lysate with SLC7A3 antibody at 0.5ug/ml. Predicted molecular weight ~67 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q8WY07
Applications Western Blot : 0.5-1ug/ml
Limitations This SLC7A3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.

Application Notes

Optimal dilution of the SLC7A3 antibody should be determined by the researcher.

Immunogen

Amino acids 1-30 (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) were used as the immunogen for the SLC7A3 antibody.

Storage

After reconstitution, the SLC7A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.