- Tel: 858.663.9055
- 
									 Email: info@nsjbio.com Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
 Email: info@nsjbio.com
Email: info@nsjbio.com
								Related Products
| 
 | 
Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.
Optimal dilution of the SLC7A3 antibody should be determined by the researcher.
Amino acids 1-30 (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) were used as the immunogen for the SLC7A3 antibody.
After reconstitution, the SLC7A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
 
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.