• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SLC22A2 Antibody / OCT2

SLC22A2 Antibody / OCT2 (R31806)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31806 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of 1) rat brain and 2) mouse brain lysate with SLC22A2 antibody. Expected molecular weight: 55-100 kDa depending on glycosylation level.
›
Western blot testing of 1) rat brain and 2) mouse brain lysate with SLC22A2 antibody. Expected molecular weight: 55-100 kDa depending on glycosylation level.
IHC testing of FFPE mouse kidney with SLC22A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat kidney with SLC22A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O15244
Applications Western blot : 0.1-0.5ug/ml
IHC-P : 0.5-1ug/ml
Limitations This SLC22A2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, FACS
    Reactivity : Human

Description

SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Application Notes

Optimal dilution of the SLC22A2 antibody should be determined by the researcher.

Immunogen

Amino acids ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN of human SLC22A2 were used as the immunogen for the SLC22A2 antibody.

Storage

After reconstitution, the SLC22A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SLC22A2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.