SLC22A2 Antibody | Organic Cation Transporter

	Catalog No	Formulation	Size	Price (USD)
	R31806	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	449
Formulation

SLC22A2 Antibody Human Kidney IHC. Immunohistochemical staining of FFPE human kidney tissue with SLC22A2 antibody at 2 ug/ml. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter involved in renal drug transport, xenobiotic uptake, and clearance of endogenous cationic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Mouse Kidney IHC. Immunohistochemical staining of FFPE mouse kidney tissue with SLC22A2 antibody at 2 ug/ml. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter responsible for renal uptake of endogenous cations, therapeutic drugs, and other xenobiotic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Rat Kidney IHC. Immunohistochemical staining of FFPE rat kidney tissue with SLC22A2 antibody. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes and allowing them to cool prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter responsible for renal uptake of endogenous cations, therapeutic drugs, and other xenobiotic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Mouse Kidney WB. Western blot testing of mouse kidney tissue lysate with SLC22A2 antibody at 0.5 ug/ml. A strong band is detected at approximately 63 kDa, consistent with the predicted molecular weight of SLC22A2. The results demonstrate specific detection of this organic cation transporter, which is highly expressed in renal tubular epithelial cells and plays a key role in the uptake and clearance of endogenous cations, therapeutic drugs, and other xenobiotic compounds.

›

SLC22A2 Antibody Human Kidney IHC. Immunohistochemical staining of FFPE human kidney tissue with SLC22A2 antibody at 2 ug/ml. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter involved in renal drug transport, xenobiotic uptake, and clearance of endogenous cationic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Mouse Kidney IHC. Immunohistochemical staining of FFPE mouse kidney tissue with SLC22A2 antibody at 2 ug/ml. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter responsible for renal uptake of endogenous cations, therapeutic drugs, and other xenobiotic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Rat Kidney IHC. Immunohistochemical staining of FFPE rat kidney tissue with SLC22A2 antibody. Heat-induced epitope retrieval (HIER) was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes and allowing them to cool prior to staining. SLC22A2 immunoreactivity is observed predominantly along the basolateral membranes and within the cytoplasm of renal tubular epithelial cells, consistent with the expected localization of this organic cation transporter responsible for renal uptake of endogenous cations, therapeutic drugs, and other xenobiotic compounds. Cell nuclei are counterstained with hematoxylin (blue).

SLC22A2 Antibody Mouse Kidney WB. Western blot testing of mouse kidney tissue lysate with SLC22A2 antibody at 0.5 ug/ml. A strong band is detected at approximately 63 kDa, consistent with the predicted molecular weight of SLC22A2. The results demonstrate specific detection of this organic cation transporter, which is highly expressed in renal tubular epithelial cells and plays a key role in the uptake and clearance of endogenous cations, therapeutic drugs, and other xenobiotic compounds.

Availability	1-3 business days
Species Reactivity	Human, Mouse, Rat
Format	Antigen affinity purified
Host	Rabbit
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity
Buffer	Lyophilized from 1X PBS with 2% Trehalose
UniProt	O15244
Localization	Cytoplasm, cell membrane
Applications	Western Blot : 0.5-1ug/ml Immunohistochemistry : 2-5ug/ml
Limitations	This SLC22A2 Antibody / Organic Cation Transporter Antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

SLC22A2 Antibody recognizes Solute Carrier Family 22 Member 2 (SLC22A2), more commonly known as Organic Cation Transporter 2 (OCT2), a membrane transporter responsible for the cellular uptake and secretion of a wide range of endogenous organic cations, metabolites, and therapeutic drugs. SLC22A2 is one of the principal transporters controlling renal handling of positively charged compounds and plays a central role in drug disposition, pharmacokinetics, and xenobiotic clearance. By mediating sodium-independent transport across the plasma membrane, SLC22A2 regulates the movement of numerous biologically active molecules between the bloodstream and renal tubular epithelial cells. Consequently, SLC22A2 Antibody is widely used to investigate organic cation transport, renal physiology, drug transport mechanisms, and transporter-mediated toxicity.

SLC22A2 is expressed predominantly on the basolateral membrane of proximal tubular epithelial cells in the kidney, where it functions alongside additional solute carrier transporters to remove endogenous metabolites and xenobiotics from the circulation. The transporter accepts a broad range of substrates, including creatinine, dopamine, choline, thiamine, metformin, cisplatin, and numerous antiviral, cardiovascular, and anticancer drugs. Genetic variation or altered expression of SLC22A2 can significantly influence drug efficacy, adverse drug reactions, and susceptibility to nephrotoxicity. These characteristics have established SLC22A2 as an important biomarker in pharmacology, nephrology, and precision medicine while making SLC22A2 Antibody a valuable tool for studies of renal transporter expression and function.

Beyond its physiological role in renal drug handling, SLC22A2 has attracted considerable attention for its involvement in drug-induced kidney injury and cancer therapy. Reduced transporter activity can decrease renal drug clearance, whereas enhanced uptake of nephrotoxic compounds may increase tubular cell injury. SLC22A2 is therefore frequently investigated during pharmaceutical development to evaluate transporter-drug interactions, predict renal clearance, and identify compounds capable of inhibiting or competing for organic cation transport. Ongoing research also suggests that altered SLC22A2 expression may contribute to chronic kidney disease, metabolic disorders, and certain malignancies, expanding its importance beyond classical renal physiology.

NSJ Bioreagents offers highly validated SLC22A2 Antibody products for reliable detection of endogenous SLC22A2 in human and animal tissues. These antibodies support investigations into organic cation transport, renal tubular biology, pharmacokinetics, drug metabolism, transporter-mediated toxicity, and kidney disease while enabling accurate characterization of SLC22A2 expression and localization. Researchers studying membrane transport systems, renal physiology, and drug development can rely on SLC22A2 Antibody for dependable and reproducible results.

Learn more about proteins involved in membrane transport, cellular metabolism and xenobiotic handling on our Metabolism Antibodies page.

Application Notes

Optimal dilution of the SLC22A2 antibody should be determined by the researcher.

Immunogen

Amino acids ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN of human SLC22A2 were used as the immunogen for the SLC22A2 antibody.

Storage

After reconstitution, the SLC22A2 Antibody / Organic Cation Transporter Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

OCT2 antibody, Organic Cation Transporter 2 antibody, Organic Cation Transport Protein 2 antibody, Solute Carrier Family 22 Member 2 antibody, Renal Organic Cation Transporter antibody, OCTN2 antibody

Related Products

1. View all SLC22A2 antibodies

SLC22A2 Antibody / Organic Cation Transporter Antibody (R31806)

Description

Application Notes

Immunogen

Storage

Alternate Names

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents