SKP2 Antibody / S-phase kinase-associated protein 2 (RQ4170)

Description

SKP2 (S-phase kinase-associated protein 2) is a key F-box protein component of the SCF (SKP1-Cullin-F-box) E3 ubiquitin ligase complex, which regulates the ubiquitination and proteasomal degradation of target proteins. SKP2 plays a critical role in cell cycle progression by targeting the cyclin-dependent kinase inhibitors p27Kip1 and p21Cip1 for degradation, thereby promoting the G1/S phase transition. As such, SKP2 functions as a central modulator of cell proliferation, differentiation, and tumorigenesis.

Aberrant overexpression of SKP2 has been observed in numerous human cancers, including breast, prostate, lung, and colorectal tumors, and is often associated with poor prognosis. Its oncogenic activity is linked to unchecked cell cycle advancement and evasion of growth suppression. Consequently, SKP2 is considered a promising target for therapeutic intervention, and its expression serves as a valuable biomarker in cancer research.

The SKP2 antibody is widely used in cancer biology and cell cycle studies to detect SKP2 protein levels and localization in both normal and malignant tissues. With proven application in immunohistochemistry, western blotting, and immunofluorescence, the SKP2 antibody enables researchers to explore the molecular mechanisms underlying cell cycle dysregulation. Whether used in basic research or translational studies, the SKP2 antibody provides high specificity and sensitivity for reliable protein detection.

Application Notes

Optimal dilution of the SKP2 antibody should be determined by the researcher.

Immunogen

Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.

Storage

After reconstitution, the SKP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.