- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
SHIP1 Antibody / INPP5D Polyclonal Antibody (RQ4421)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
RQ4421 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Host | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q92835 |
| Localization | Membrane, cytoplasm |
| Applications | Western blot: 0.5-1ug/ml Immunohistochemistry (FFPE): 1-2ug/ml |
| Limitations | This SHIP1 Antibody / INPP5D Polyclonal Antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
SHIP1 Antibody / INPP5D Polyclonal Antibody targets SHIP1, an SH2 domain-containing inositol 5-phosphatase encoded by the INPP5D gene. This enzyme regulates phosphoinositide signaling and contributes to the control of immune-cell activation, proliferation, migration, and survival. SHIP1 hydrolyzes phosphatidylinositol 3,4,5-trisphosphate (PIP3) to generate phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2), modifying the lipid signals that recruit regulatory proteins to cellular membranes. Through this activity, SHIP1 influences signaling pathways downstream of immune receptors, cytokine receptors, and growth factor receptors.
The N-terminal Src homology 2 (SH2) domain of SHIP1 recognizes phosphorylated tyrosine-containing motifs within receptor-associated signaling complexes. This interaction helps recruit the enzyme to membrane-proximal regions where phosphoinositide signaling occurs. SHIP1 also contains a catalytic phosphatase domain and C-terminal regions that interact with adaptor proteins, including SHC1 and DOK-family proteins. These structural features allow SHIP1 to function as both a lipid-modifying enzyme and a component of multiprotein signaling assemblies.
SHIP1 is particularly important in hematopoietic cells. In B lymphocytes, recruitment of SHIP1 downstream of the inhibitory Fc gamma RIIB receptor helps restrain activation signals initiated through the B-cell receptor. In myeloid cells, SHIP1 regulates responses associated with cytokine signaling, chemotaxis, and inflammatory activation. Its effects depend on receptor engagement and the relative activities of other phosphoinositide-modifying enzymes. Because PI(3,4)P2 also participates in signal transduction, SHIP1 activity can redirect signaling rather than simply terminate it.
SHIP1 shares catalytic functions with SHIP2, encoded by INPPL1, but the two proteins differ in their expression patterns and physiological roles. SHIP1 is strongly associated with hematopoietic signaling, whereas SHIP2 is more broadly expressed. These differences are relevant when investigating phosphoinositide regulation in distinct cellular environments.
Altered INPP5D function has been investigated in immune dysregulation, hematologic malignancies, and neuroinflammatory disease. Microglial SHIP1 has attracted particular attention because genetic studies implicate INPP5D in susceptibility to Alzheimer's disease. SHIP1 Antibody supports investigations into immune receptor regulation, phosphoinositide metabolism, and the molecular mechanisms governing hematopoietic cell homeostasis.
For an alternative reagent with knockout-supported Western blot specificity validation and intracellular flow cytometry data, explore our INPP5D Antibody (RQ8586).
Optimal dilution of the SHIP1 Antibody / INPP5D Polyclonal Antibody should be determined by the researcher.
Amino acids NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ from the human protein were used as the immunogen for the SHIP1 antibody.
After reconstitution, the SHIP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
SH2-Containing Inositol Phosphatase 1 antibody, SH2 Domain-Containing Inositol 5-Phosphatase 1 antibody, Inositol Polyphosphate-5-Phosphatase D antibody, Inositol Polyphosphate 5-Phosphatase D antibody, Phosphatidylinositol-3,4,5-Trisphosphate 5-Phosphatase 1 antibody, SHIP-1 antibody, SIP-145 antibody, Inositol Polyphosphate-5-Phosphatase of 145 kDa antibody, SHIP1 Lipid Phosphatase antibody, INPP5D Inositol Phosphatase antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
