• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SECTM1 Antibody

SECTM1 Antibody (R32327)

  Catalog No Formulation Size Price (USD)  
Image R32327 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9JL59
Applications Western Blot : 0.1-0.5ug/ml
Limitations This SECTM1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Application Notes

Optimal dilution of the SECTM1 antibody should be determined by the researcher.

Immunogen

Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

Storage

After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.