- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
SAPK4 antibody targets Stress-activated protein kinase 4, a serine-threonine protein kinase encoded by the MAPK13 gene and a member of the p38 mitogen-activated protein kinase family. Stress-activated protein kinase 4 is predominantly localized in the cytoplasm, with inducible nuclear translocation following activation, and functions as a key mediator of cellular responses to environmental stress signals. As part of the MAPK signaling cascade, SAPK4 integrates upstream signals from inflammatory cytokines, osmotic stress, ultraviolet radiation, and oxidative stress to regulate downstream transcriptional and post-translational events.
Stress-activated protein kinase 4 plays an important role in regulating gene expression programs associated with inflammation, epithelial differentiation, and stress adaptation. Unlike other p38 family members, MAPK13 shows distinct expression patterns, with relatively higher expression in epithelial tissues such as intestine, lung, and skin, as well as in certain immune and tumor-derived cell types. This tissue-selective expression profile makes SAPK4 a biologically relevant target for studying epithelial stress signaling and barrier-associated immune responses.
Functionally, SAPK4 phosphorylates a range of substrates involved in transcriptional control, cytoskeletal regulation, and protein stability. Activation of SAPK4 has been linked to modulation of transcription factors, regulation of inflammatory mediator production, and coordination of stress-induced cellular remodeling. Through these activities, Stress-activated protein kinase 4 contributes to maintaining cellular homeostasis under adverse conditions while also participating in pathological signaling when dysregulated.
In the context of disease, altered MAPK13 signaling has been reported in inflammatory disorders, gastrointestinal pathology, and several cancer types, where SAPK4 activity may influence tumor cell survival, proliferation, and stress tolerance. Its involvement in epithelial-derived cancers and inflammation-associated tumor microenvironments has increased interest in SAPK4 as both a mechanistic signaling node and a potential therapeutic research target.
A SAPK4 antibody is a valuable tool for investigating MAPK pathway dynamics, stress-responsive kinase activation, and tissue-specific signaling patterns. Such antibodies can be applied to the study of SAPK4 expression, localization, and regulation in cellular and tissue-based research models. By enabling detection of Stress-activated protein kinase 4 in diverse experimental contexts, this antibody supports research into MAPK13-driven signaling mechanisms and their relevance to inflammation, epithelial biology, and disease-associated stress responses.
Optimal dilution of the SAPK4 antibody should be determined by the researcher.
Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.
After reconstitution, the SAPK4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.