- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
SAFB Antibody / Scaffold Attachment Factor Antibody recognizes Scaffold Attachment Factor B (SAFB), a multifunctional nuclear protein that integrates chromatin organization, transcriptional regulation and RNA metabolism. SAFB binds scaffold or matrix attachment regions of DNA while also interacting with numerous transcription factors, RNA-binding proteins and components of the spliceosome. Through these diverse molecular interactions, SAFB helps coordinate gene expression by linking chromatin architecture with transcription and post-transcriptional RNA processing. NSJ Bioreagents provides SAFB antibodies for studies of nuclear organization, epigenetics and RNA biology.
SAFB is expressed in a wide variety of tissues and is localized predominantly within the nucleus, where it functions as both a transcriptional coregulator and an RNA-binding protein. The protein associates with chromatin remodeling complexes, hormone receptors and transcription factors to influence gene activation or repression in a context-dependent manner. SAFB also contributes to alternative RNA splicing, RNA stability and the cellular response to stress, allowing coordinated regulation of gene expression at multiple levels. These activities make SAFB an important regulator of nuclear structure and genome function.
Altered SAFB expression or activity has been associated with breast cancer, prostate cancer, neurological disorders and other diseases involving disrupted transcriptional control or RNA processing. SAFB has been extensively studied for its interactions with estrogen receptor signaling pathways and its role in hormone-responsive cancers, while more recent work has highlighted its participation in DNA damage responses, stress granule formation and epigenetic regulation. As a result, SAFB has become an important research target in cancer biology, endocrinology and molecular genetics.
An SAFB Antibody is a valuable reagent for detecting this multifunctional nuclear protein by Western blotting, immunohistochemistry, immunofluorescence, immunoprecipitation and related immunoassays. By enabling reliable analysis of protein expression and subcellular localization, an SAFB Antibody supports investigations of chromatin organization, transcriptional regulation, RNA processing and nuclear signaling.
Researchers investigating nuclear gene regulation and chromatin architecture may also be interested in our Nuclear Marker Antibodies page, featuring antibodies against proteins involved in transcription, RNA processing and nuclear organization.
Differences in protocols and secondary/substrate sensitivity may require the SAFB Antibody / Scaffold attachment factor B1 to be titrated for optimal performance.
Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.
After reconstitution, the SAFB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
SAFB antibody, Scaffold Attachment Factor B antibody, Scaffold Attachment Factor antibody, HET antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.