• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SAFB Antibody / Scaffold attachment factor B1

SAFB Antibody / Scaffold attachment factor B1 (R32563)

  Catalog No Formulation Size Price (USD)  
Image R32563 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with SAFB antibody at 0.5ug/ml. Predicted molecular weight: ~103 kDa but routinley observed at ~150 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q15424
Applications Western Blot : 0.5-1ug/ml
Limitations This SAFB antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the SAFB antibody to be titrated for optimal performance.

Immunogen

Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Storage

After reconstitution, the SAFB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.