• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RUNX2 Antibody

RUNX2 Antibody (R31577)

  Catalog No Formulation Size Price (USD)  
Image R31577 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of RUNX2 antibody and Lane 1: HeLa; 2: A431; 3: K562; 4: Jurkat. Predicted molecular weight: 50-60 kDa.
Western blot testing of RUNX2 antibody and recombinant human protein (0.5ng)
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Gene ID 860
Applications Western Blot : 0.5-1ug/ml
Limitations This RUNX2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : IHC, FACS, WB, ELISA
    Reactivity : Human
  • Applications : IHC, ELISA
    Reactivity : Human

Description

Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

Application Notes

The stated application concentrations are suggested starting amounts. Titration of the RUNX2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Immunogen

An amino acid sequence from the middle region of human RUNX2 (DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN) was used as the immunogen for this RUNX2 antibody (100% mouse homology).

Storage

After reconstitution, the RUNX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.