• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RPS6 Antibody

RPS6 Antibody (R32746)

  Catalog No Formulation Size Price (USD)  
Image R32746 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC testing of FFPE human intestinal cancer tissue with RPS6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with RPS6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat kidney tissue with RPS6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat brain tissue with RPS6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat testis, 2) mouse testis, 3) human MCF7 and 4) human A549 lysate with RPS6 antibody at 0.5ug/ml. Predicted molecular weight ~29 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P62753
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This RPS6 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC, WB, FACS, IF, ELISA
    Reactivity : Human, Rat
    Pred. Reactivity : Mouse, Primate
  • Applications : IHC, FACS, WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Primate, Chicken, Xenopus
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Primate
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Mouse, Primate, Rat

Description

Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

Application Notes

Optimal dilution of the RPS6 antibody should be determined by the researcher.

Immunogen

Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

Storage

After reconstitution, the RPS6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.