- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
RENT1 antibody, also known as hUPF1 antibody, recognizes Up-frameshift suppressor 1, a highly conserved ATP-dependent RNA helicase encoded by the human UPF1 gene on chromosome 19p13.11. Commonly referred to as RENT1, regulator of nonsense transcripts 1, or hUPF1 in the literature, this protein is predominantly localized in the cytoplasm and shuttles between the nucleus and cytoplasm. RENT1 antibody targets a central component of the nonsense-mediated mRNA decay pathway, a surveillance mechanism that identifies and degrades mRNAs containing premature termination codons to prevent production of truncated proteins.
Up-frameshift suppressor 1 is a member of the superfamily 1 helicase family and contains conserved ATP-binding and RNA-binding domains that couple ATP hydrolysis to RNA remodeling. Through interactions with additional NMD factors such as UPF2 and UPF3, hUPF1 forms a surveillance complex associated with translating ribosomes. Upon recognition of aberrant termination events, hUPF1 undergoes regulated phosphorylation that promotes recruitment of decay machinery and mRNA degradation. Beyond nonsense-mediated mRNA decay, RENT1 participates in general mRNA turnover, Staufen-mediated decay, and regulation of transcripts involved in stress responses, proliferation, and differentiation.
UPF1 is broadly expressed across tissues, reflecting its fundamental role in post-transcriptional gene regulation. Subcellularly, hUPF1 is primarily cytoplasmic and can associate with processing bodies and sites of active translation. Structurally, it contains a helicase core domain and regulatory regions that coordinate RNA binding, ATPase activity, and protein-protein interactions. Dysregulation of UPF1 expression or activity has been implicated in cancer biology, viral replication, and neurodevelopmental disorders, where altered RNA surveillance influences transcript stability and gene expression programs.
RENT1 antibody is suitable for detecting hUPF1 expression in studies of RNA quality control, translational regulation, and disease-associated alterations in mRNA decay pathways. By enabling analysis of UPF1 distribution and abundance, this antibody supports research into fundamental mechanisms of RNA metabolism and cellular homeostasis.
Synonyms
RENT1 antibody, hUPF1 antibody, UPF1 antibody, Up-frameshift suppressor 1 antibody, Regulator of nonsense transcripts 1 antibody, ATP-dependent RNA helicase UPF1 antibody, UPF1 RNA helicase antibody
Optimal dilution of the RENT1 antibody should be determined by the researcher.
Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody.
After reconstitution, the RENT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.