• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RENT1 Antibody / hUPF1

RENT1 Antibody / hUPF1 [clone 11E7.] (RQ5658)

  Catalog No Formulation Size Price (USD)  
Image RQ5658 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human breast cancer with RENT1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse intestine with RENT1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse intestine with RENT1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat intestine with RENT1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human U-2 OS cells with RENT1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HepG2, 2) Raji, 3) PC-3, 4) HeLa and 5) HEK293 lysate with RENT1 antibody. Predicted molecular weight ~124 kDa, but routinely observed at 130-140 kDa.
Western blot testing of 1) rat brain, 2) mouse brain and 3) mouse RAW264.7 lysate with RENT1 antibody. Predicted molecular weight ~124 kDa, but routinely observed at 130-140 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal
Isotype Mouse IgG2b
Clone Name 11E7.
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q92900
Localization Nuclear, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry : 1-2ug/ml
Immunofluorescence : 2-4ug/ml
Limitations This RENT1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the RENT1 antibody should be determined by the researcher.

Immunogen

Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody.

Storage

After reconstitution, the RENT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.