• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RAD51 Antibody / RAD51A

RAD51 Antibody / RAD51A (RQ4603)

  Catalog No Formulation Size Price (USD)  
Image RQ4603 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
RAD51 Antibody Human Testis IHC. Immunohistochemical staining of FFPE human testis demonstrates RAD51 expression using a RAD51 antibody at 1 ug/ml. RAD51, also known as RAD51 Recombinase, is a key DNA repair protein that mediates homologous recombination and maintains genomic stability during meiosis and spermatogenesis. Predominantly nuclear staining is observed within seminiferous tubules, consistent with the high levels of DNA repair activity required for germ cell development. Heat induced epitope retrieval was performed by boiling tissue sections in pH6 10 mM citrate buffer for 10 to 20 minutes followed by cooling at room temperature for 20 minutes prior to staining. These results support the utility of RAD51 Antibody for investigating DNA damage responses, meiotic recombination, and reproductive biology.
RAD51 Antibody Human Placenta IHC. Immunohistochemical staining of FFPE human placenta demonstrates RAD51 expression using a RAD51 antibody. RAD51, also known as RAD51 Recombinase, is a key DNA repair protein involved in homologous recombination and the maintenance of genomic stability. Strong nuclear staining is observed in trophoblastic epithelial cells, consistent with the high proliferative activity and DNA repair requirements of placental tissues. Heat induced epitope retrieval was performed by boiling tissue sections in pH6 10 mM citrate buffer for 10 to 20 minutes followed by cooling prior to staining. These results support the utility of RAD51 Antibody for investigating DNA damage responses, genome maintenance, and developmental biology.
RAD51 Antibody Mouse Brain IHC. Immunohistochemical staining of FFPE mouse brain demonstrates RAD51 expression using a RAD51 antibody at 1 ug/ml. RAD51, also known as RAD51 Recombinase, is a central DNA repair protein that mediates homologous recombination and maintains genomic stability. Predominantly nuclear staining is observed in cells of the cerebellar granular layer, consistent with the requirement for efficient DNA damage responses in neural tissues. Heat induced epitope retrieval was performed by boiling tissue sections in pH6 10 mM citrate buffer for 10 to 20 minutes followed by cooling at room temperature for 20 minutes prior to staining. These results support the utility of RAD51 Antibody for investigating DNA repair pathways, genome maintenance, and nervous system development.
RAD51 Antibody Human Cell Lines WB. Western blot analysis of RAD51 expression using a RAD51 antibody at 0.5 ug/ml. Lane 1: human HeLa cell lysate. Lane 2: human A431 cell lysate. Lane 3: human 293T cell lysate. Lane 4: human K562 cell lysate. Lane 5: human Jurkat cell lysate. Lane 6: human A549 cell lysate. Lane 7: human Caco-2 cell lysate. RAD51, also known as RAD51 Recombinase, is a key DNA repair protein that mediates homologous recombination and preserves genomic stability. A prominent band is detected at approximately 37 kDa in all cell lines, consistent with the predicted molecular weight of RAD51. Faint higher molecular weight bands are also observed in some lysates and may represent post translationally modified or multimeric forms of RAD51. These results demonstrate endogenous expression of this DNA repair protein across multiple human cell types and support the utility of RAD51 Antibody for studies of DNA damage responses, genome maintenance, and cancer biology.
Western blot testing of 1) rat testis, 2) mouse testis and 3) mouse thymus lysate with RAD51 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
RAD51 Antibody Rat Brain IHC. Immunohistochemical staining of FFPE rat brain demonstrates RAD51 expression using a RAD51 antibody at 1 ug/ml. RAD51, also known as RAD51 Recombinase, is a central DNA repair protein that mediates homologous recombination and preserves genomic stability in proliferating and differentiated cells. Predominantly nuclear staining is observed in scattered neural cells, consistent with the requirement for efficient DNA damage responses and chromosome maintenance in the nervous system. Heat induced epitope retrieval was performed by boiling tissue sections in pH6 10 mM citrate buffer for 10 to 20 minutes followed by cooling at room temperature for 20 minutes prior to staining. These results support the utility of RAD51 Antibody for investigating DNA repair pathways, genome maintenance, and neural development.
RAD51 Antibody U-2 OS Cells IF. Immunofluorescent staining of FFPE human U-2 OS cells demonstrates RAD51 expression using a RAD51 antibody (green) with DAPI nuclear counterstain (blue). RAD51, also known as RAD51 Recombinase, is a key DNA repair protein that mediates homologous recombination and maintains genomic stability following DNA damage. Predominantly nuclear localization is observed, consistent with the role of RAD51 in DNA double strand break repair and replication fork protection. Heat induced epitope retrieval was performed by steaming sections in pH6 citrate buffer for 20 minutes prior to staining. These results support the utility of RAD51 Antibody for investigating DNA damage responses, homologous recombination, and genome maintenance in human cells.
RAD51 Antibody SiHa Cells FACS. Flow cytometric analysis of human SiHa cells was performed using a RAD51 antibody at 1 ug per million cells following blocking with goat sera. RAD51, also known as RAD51 Recombinase, is a key DNA repair protein that mediates homologous recombination and preserves genomic stability following DNA damage. Red histogram: cells alone. Green histogram: isotype control. Blue histogram: RAD51 antibody. The pronounced rightward shift of the RAD51 antibody signal relative to the controls demonstrates specific intracellular detection of endogenous RAD51 in SiHa cells. These results support the utility of RAD51 Antibody for studies of DNA damage responses, homologous recombination, and genome maintenance in human cancer cells.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q06609
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

RAD51 Antibody specifically binds DNA repair protein RAD51 homolog 1, also known as RAD51A, a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis.

Explore our RAD51 Antibody page for additional antibodies against RAD51 Recombinase, including IHC and Protein Microarray validated reagents for studies of homologous recombination, DNA damage responses, and genome stability.

Application Notes

Optimal dilution of the RAD51 antibody should be determined by the researcher.

Immunogen

Amino acids KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK were used as the immunogen for the RAD51 antibody.

Storage

After reconstitution, the RAD51 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.