- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.
Optimal dilution of the RAB18 antibody should be determined by the researcher.
Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.
After reconstitution, the RAB18 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.