• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> RAB13 Antibody

RAB13 Antibody (R32126)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32126 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human MCF7 cells with RAB13 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human MCF7 cells with RAB13 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) Caco-2, 3) MCF7 and 4) 293T cell lysate with RAB13 antibody. Expected molecular weight: ~23 kDa.
Flow cytometry testing of human U-87 MG cells with RAB13 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB13 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P51153
Localization Cytoplasmic, membrane
Applications Western blot : 0.5-1ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This RAB13 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS, Direct ELISA
    Reactivity : Human, Rat

Description

Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

Application Notes

Optimal dilution of the RAB13 antibody should be determined by the researcher.

Immunogen

Amino acids NKCDMEAKRKVQKEQADKLAREHGIRFFET of human RAB13 were used as the immunogen for the RAB13 antibody.

Storage

After reconstitution, the RAB13 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all RAB13 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.