RAB11 Antibody / Rab11A (R32159)

Description

RAB11 is a member of the RAB family of small GTPases, which are master regulators of intracellular vesicle trafficking. Specifically, RAB11 is critical for regulating recycling endosome dynamics and the trafficking of cargo from recycling endosomes back to the plasma membrane. It plays a vital role in processes such as receptor recycling, cytokinesis, epithelial polarity, and membrane protein localization.

RAB11 is widely expressed and functionally conserved across species. It is essential for maintaining cell surface receptor levels, especially in rapidly cycling cells such as epithelial and immune cells. Dysregulation of RAB11-mediated trafficking has been implicated in several disease processes, including cancer, neurodegenerative disorders, and infectious diseases, where altered membrane trafficking affects signaling, adhesion, and immune responses.

The RAB11 antibody is an indispensable tool for researchers studying membrane trafficking, cell polarity, and endosomal recycling. With validated performance in applications such as immunofluorescence, western blotting, and immunohistochemistry, the RAB11 antibody enables specific and sensitive detection of endogenous RAB11. The RAB11 antibody is especially useful for visualizing subcellular localization and vesicle trafficking dynamics in both normal and pathological conditions.

Application Notes

Optimal dilution of the RAB11 antibody should be determined by the researcher.

Immunogen

Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody.

Storage

After reconstitution, the RAB11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.