• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> PYY Antibody / Peptide YY

PYY Antibody / Peptide YY (R32451)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32451 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Immunofluorescent staining of FFPE rat stomach tissue with PYY antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE rat stomach tissue with PYY antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse intestine with PYY antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE mouse intestine with PYY antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE mouse pancreas with PYY antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE rat intestine with PYY antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE rat pancreas with PYY antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9EPS2
Applications Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence : 5ug/ml
Limitations This PYY antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The Peptide YY antibody is designed to detect mouse and rat peptide YY (PYY), a gut hormone secreted by enteroendocrine L cells of the distal ileum and colon following food intake. In rodents, PYY functions as a key regulator of satiety and gastrointestinal motility, acting through neuropeptide Y receptors to reduce appetite and slow digestion. Like the human hormone, rodent PYY circulates as PYY1-36 and PYY3-36, but minor sequence differences alter receptor interactions and signaling. The Peptide YY antibody provides sensitive detection of PYY in rodents, supporting preclinical studies of energy balance and gut-brain communication.

Rodent PYY shares extensive homology with its human counterpart, yet the differences in receptor binding make animal models essential for investigating pharmacological strategies targeting PYY. Following nutrient ingestion, rodent PYY is released in proportion to caloric intake, influencing feeding behavior, gastric emptying, and insulin regulation. The Peptide YY antibody enables accurate detection of this hormone in both tissue and serum, providing a foundation for metabolic and endocrine research.

In immunohistochemistry, the Peptide YY antibody marks PYY-positive L cells scattered throughout the intestinal mucosa, revealing changes in hormone cell density under different dietary or experimental conditions. In immunofluorescence, it highlights storage granules within enteroendocrine cells, while in western blotting and ELISA, it quantifies PYY levels in tissue extracts and plasma samples. Its consistency supports reproducible measurement of rodent gut hormones across experiments.

This antibody is particularly important in obesity and diabetes research, where rodent models provide mechanistic insights into PYY secretion and function. It is also widely used in neurobiology, as PYY signals to the brain through vagal afferents and hypothalamic pathways, influencing energy balance and feeding behavior. Synonym phrases such as mouse PYY antibody, rat peptide YY antibody, and rodent satiety hormone antibody improve accessibility for researchers in different disciplines.

By ensuring validated and reproducible detection, the Peptide YY antibody supports high-quality research into rodent gut hormones and metabolic regulation. NSJ Bioreagents supplies this antibody under stringent quality standards, giving scientists confidence in applications such as western blotting, immunohistochemistry, immunofluorescence, and ELISA. With specificity for rodent PYY, the Peptide YY antibody is a critical tool for advancing preclinical studies in energy balance, appetite regulation, and gut-brain signaling.

Application Notes

Optimal dilution of the PYY antibody should be determined by the researcher.

Immunogen

Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the PYY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Peptide YY antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.