- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
PTPN11 Antibody / SHP2 / Tyrosine-protein phosphatase non-receptor type 11 [clone 2E6] (RQ4920)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
RQ4920 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Purified |
| Host | Mouse |
| Clonality | Monoclonal (mouse origin) |
| Isotype | Mouse IgG2b |
| Clone Name | 2E6 |
| Purity | Purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q06124 |
| Localization | Cytoplasmic, Nuclear |
| Applications | Western Blot : 0.5-1ug/ml Immunohistochemistry (FFPE) : 2-5ug/ml Immunofluorescence : 5ug/ml Flow Cytometry : 1-3ug/million cells |
| Limitations | This PTPN11 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
PTPN11 Antibody targets Tyrosine-protein phosphatase non-receptor type 11, also known as SHP2, a cytoplasmic protein tyrosine phosphatase encoded by the PTPN11 gene that plays a central role in intracellular signal transduction. SHP2 is a widely expressed signaling regulator that participates in multiple growth factor, cytokine, and hormone signaling pathways. Through its phosphatase activity and adaptor functions, SHP2 integrates extracellular cues with downstream cellular responses that control proliferation, differentiation, migration, and survival.
Functionally, Tyrosine-protein phosphatase non-receptor type 11 contains two N-terminal SH2 domains that mediate binding to phosphorylated tyrosine residues on activated receptors and adaptor proteins. This interaction relieves autoinhibition of the phosphatase domain, enabling SHP2 to dephosphorylate specific substrates and propagate signaling cascades. SHP2 is a well-established positive regulator of the MAPK signaling pathway and contributes to sustained ERK activation following receptor stimulation. A PTPN11 Antibody enables investigation of phosphatase-dependent signaling mechanisms and SHP2-mediated pathway regulation in research settings.
PTPN11 expression is observed across many tissues and cell types, reflecting its involvement in fundamental signaling processes. At the subcellular level, SHP2 is primarily localized to the cytoplasm but is dynamically recruited to activated receptor complexes at the plasma membrane. This regulated localization allows SHP2 to function as a signal-responsive modulator that links receptor activation to intracellular signaling networks. Changes in SHP2 expression or distribution may reflect altered signaling states or cellular responses to external stimuli.
At the molecular level, SHP2 consists of tandem SH2 domains, a central protein tyrosine phosphatase domain, and a C-terminal tail containing regulatory phosphorylation sites. These structural features enable precise control of enzymatic activity and protein-protein interactions. Post-translational modifications, including phosphorylation, further regulate SHP2 activity and interactions, contributing to fine-tuning of signaling outputs across different cellular contexts.
From a biological and disease relevance perspective, PTPN11 has been extensively studied in developmental biology and disease research. Germline and somatic alterations in PTPN11 are associated with dysregulated signaling and have been implicated in developmental syndromes and cancers. Aberrant SHP2 activity can lead to sustained pathway activation and altered cellular behavior, highlighting its importance as a regulator of signal fidelity and cellular homeostasis.
PTPN11 Antibody reagents are valuable tools for studying protein tyrosine phosphatase signaling, receptor-mediated pathway regulation, and intracellular signal integration. These antibodies support research into growth factor signaling, oncogenic pathway activation, and mechanisms governing cellular responsiveness to external cues. NSJ Bioreagents provides PTPN11 Antibody products intended for research use.
Optimal dilution of the PTPN11 antibody should be determined by the researcher.
Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK from the human protein were used as the immunogen for the PTPN11 antibody.
After reconstitution, the PTPN11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
