• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PRDM14 Antibody

PRDM14 Antibody (RQ6394)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6394 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE human breast cancer with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human breast cancer with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal clear cell carcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human HeLa cells with PRDM14 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) rat testis, 2) rat spleen, 3) rat C6, 4) rat PC-12, 5) mouse testis, 6) mouse spleen, 7) mouse NIH 3T3 and 8) mouse Neuro-2a cell lysate with PRDM14 antibody. Predicted molecular weight: ~64 kDa.
Flow cytometry testing of human SiHa cells with PRDM14 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PRDM14 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9GZV8
Localization Nuclear
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This PRDM14 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow, Dog, Mouse, Pig, Rat

Description

This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.

Application Notes

Optimal dilution of the PRDM14 antibody should be determined by the researcher.

Immunogen

Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.

Storage

After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PRDM14 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.