• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PML Antibody / Promyelocytic leukemia protein

PML Antibody / Promyelocytic leukemia protein (R32552)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32552 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
›
Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
IHC testing of FFPE human intestinal cancer tissue with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with PML antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PML antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P29590
Localization Nuclear, cytoplasmic (isoform dependent)
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This PML antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the PML antibody to be titrated for optimal performance.

Immunogen

Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.

Storage

After reconstitution, the PML antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PML antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.