- Tel: 858.663.9055
- 
									 Email: info@nsjbio.com Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
 Email: info@nsjbio.com
Email: info@nsjbio.com
								Related Products
| 
 | 
EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2), also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene. Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, the alpha subunit of eukaryotic protein synthesis initiation factor-2, leading to the inhibition of protein synthesis. By FISH analysis, Squire et al. (1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21. Ben-Asouli et al. (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield. IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region. Taylor et al. (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon. They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR. E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth.
Optimal dilution of the PKR antibody should be determined by the researcher.
Amino acids EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC of human PKR were used as the immunogen for the PKR antibody.
After reconstitution, the PKR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
 
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.