- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
PITX2 Antibody / Pituitary homeobox 2 (RQ5602)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
RQ5602 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q99697 |
| Applications | Western Blot : 0.25-0.5ug/ml Flow Cytometry : 1-3ug/million cells |
| Limitations | This PITX2 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
PITX2 antibody targets Pituitary homeobox 2, encoded by the PITX2 gene. Pituitary homeobox 2 is a nuclear transcription factor belonging to the paired-like homeodomain family, characterized by a conserved homeobox DNA-binding domain that regulates gene transcription during development. PITX2 plays a central role in establishing left-right asymmetry and controlling organ morphogenesis during embryogenesis.
Functionally, Pituitary homeobox 2 regulates transcriptional programs involved in cell fate determination, tissue patterning, and differentiation. It acts downstream of signaling pathways such as Wnt and TGF-beta, integrating extracellular cues into gene expression responses. A PITX2 antibody supports research focused on developmental transcriptional regulation and homeobox gene function.
PITX2 expression is tightly regulated spatially and temporally, with prominent roles in developing cardiac tissue, ocular structures, craniofacial regions, and skeletal muscle precursors. Subcellular localization is predominantly nuclear, consistent with its role as a transcription factor, although expression levels and localization patterns vary depending on developmental stage and cell type.
From a disease-relevance perspective, altered PITX2 expression or mutation has been associated with congenital disorders, including Axenfeld-Rieger syndrome, as well as cardiovascular abnormalities. Dysregulation of PITX2 has also been explored in cancer biology, where aberrant transcription factor activity may influence proliferation, migration, and epithelial-mesenchymal transition. These findings highlight PITX2 as a critical regulator of both developmental and disease-associated transcriptional networks.
At the molecular level, Pituitary homeobox 2 contains a homeodomain responsible for sequence-specific DNA binding, along with regulatory regions that mediate protein-protein interactions and transcriptional control. Post-translational regulation and isoform diversity can influence PITX2 activity and apparent behavior in biochemical assays without altering its core DNA-binding function. PITX2 antibody reagents support research applications focused on transcriptional regulation, developmental biology, and disease-associated gene expression pathways, with NSJ Bioreagents providing reagents intended for research use.
Optimal dilution of the PITX2 antibody should be determined by the researcher.
Amino acids METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK were used as the immunogen for the PITX2 antibody.
After reconstitution, the PITX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
