• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> PIAS4 Antibody / PIASg

PIAS4 Antibody / PIASg (R32550)

  Catalog No Formulation Size Price (USD)  
Image R32550 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with PIAS4 antibody at 0.5ug/ml. Predicted/observed molecular weight ~57 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q8N2W9
Applications Western Blot : 0.5-1ug/ml
Limitations This PIAS4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat

Description

Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the PIAS4 antibody to be titrated for optimal performance.

Immunogen

Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.

Storage

After reconstitution, the PIAS4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.