- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.
Differences in protocols and secondary/substrate sensitivity may require the PIAS4 antibody to be titrated for optimal performance.
Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.
After reconstitution, the PIAS4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.