• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> PIAS3 Antibody

PIAS3 Antibody (RQ4115)

  Catalog No Formulation Size Price (USD)  
Image RQ4115 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HeLa, 2) U-87 MG, 3) COLO320, 4) HepG2, 5) rat brain and 6) mouse NIH3T3 lysate with PIAS3 antibody at 0.5ug/ml. Predicted molecular weight ~68 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9Y6X2
Applications Western Blot : 0.5-1ug/ml
Limitations This PIAS3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.

Application Notes

Optimal dilution of the PIAS3 antibody should be determined by the researcher.

Immunogen

Amino acids QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF from the human protein were used as the immunogen for the PIAS3 antibody.

Storage

After reconstitution, the PIAS3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.