PGRMC1 Antibody | HPR6.6 | IZA | R31787 NSJ Bioreagents

	Catalog No	Formulation	Size	Price (USD)
	R31787	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	449
Formulation

PGRMC1 Antibody Human Colon Cancer IHC. IHC staining of FFPE human colon cancer tissue with PGRMC1 Antibody. HIER was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes, followed by cooling prior to staining. The section was incubated with PGRMC1 antibody, followed by HRP-conjugated secondary antibody and DAB chromogen detection. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody demonstrates cytoplasmic staining in tumor cells and supports studies of steroid signaling, cell survival pathways and cancer-associated PGRMC1 expression.

PGRMC1 Antibody Human Renal Cancer IHC. IHC staining of FFPE human renal cancer tissue with PGRMC1 Antibody. HIER was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes, followed by cooling prior to staining. The section was incubated with PGRMC1 antibody, followed by HRP-conjugated secondary antibody and DAB chromogen detection. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody shows cytoplasmic staining in renal tumor cells and supports research into cancer biology, steroid signaling regulation and cell survival pathways.

PGRMC1 Antibody Human and Rodent WB. Western blot testing of human HeLa, 293T, Jurkat and U-251 cell lysates, along with rat and mouse liver tissue lysates, with PGRMC1 Antibody. Lane 1: HeLa; Lane 2: 293T; Lane 3: Jurkat; Lane 4: U-251; Lane 5: rat liver; Lane 6: mouse liver. Expected molecular weight: ~22 kDa. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody detects endogenous PGRMC1 expression and supports studies of steroid signaling pathways, cancer biology and cell survival regulation.

PGRMC1 Antibody Human Intestine Cancer IF. Immunofluorescent staining of FFPE human intestine cancer tissue with PGRMC1 Antibody at 5 ug/ml. HIER was performed using pH 8 EDTA buffer, followed by blocking with 10% goat serum. The tissue section was incubated with rabbit anti-PGRMC1 antibody overnight at 4Â°C, followed by Cy conjugated goat anti-rabbit IgG secondary antibody (red). Nuclei were counterstained with DAPI (blue). PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody demonstrates cytoplasmic staining and supports research into steroid signaling pathways, cancer biology and cell survival regulation.

›

PGRMC1 Antibody Human Colon Cancer IHC. IHC staining of FFPE human colon cancer tissue with PGRMC1 Antibody. HIER was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes, followed by cooling prior to staining. The section was incubated with PGRMC1 antibody, followed by HRP-conjugated secondary antibody and DAB chromogen detection. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody demonstrates cytoplasmic staining in tumor cells and supports studies of steroid signaling, cell survival pathways and cancer-associated PGRMC1 expression.

PGRMC1 Antibody Human Renal Cancer IHC. IHC staining of FFPE human renal cancer tissue with PGRMC1 Antibody. HIER was performed by boiling tissue sections in pH 8 EDTA buffer for 20 minutes, followed by cooling prior to staining. The section was incubated with PGRMC1 antibody, followed by HRP-conjugated secondary antibody and DAB chromogen detection. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody shows cytoplasmic staining in renal tumor cells and supports research into cancer biology, steroid signaling regulation and cell survival pathways.

PGRMC1 Antibody Human and Rodent WB. Western blot testing of human HeLa, 293T, Jurkat and U-251 cell lysates, along with rat and mouse liver tissue lysates, with PGRMC1 Antibody. Lane 1: HeLa; Lane 2: 293T; Lane 3: Jurkat; Lane 4: U-251; Lane 5: rat liver; Lane 6: mouse liver. Expected molecular weight: ~22 kDa. PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody detects endogenous PGRMC1 expression and supports studies of steroid signaling pathways, cancer biology and cell survival regulation.

PGRMC1 Antibody Human Intestine Cancer IF. Immunofluorescent staining of FFPE human intestine cancer tissue with PGRMC1 Antibody at 5 ug/ml. HIER was performed using pH 8 EDTA buffer, followed by blocking with 10% goat serum. The tissue section was incubated with rabbit anti-PGRMC1 antibody overnight at 4°C, followed by Cy conjugated goat anti-rabbit IgG secondary antibody (red). Nuclei were counterstained with DAPI (blue). PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody demonstrates cytoplasmic staining and supports research into steroid signaling pathways, cancer biology and cell survival regulation.

Availability	1-3 business days
Species Reactivity	Human, Mouse, Rat
Format	Antigen affinity purified
Host	Rabbit
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity
Buffer	Lyophilized from 1X PBS with 2% Trehalose
UniProt	O00264
Localization	Cytoplasmic, cell membrane, nuclei
Applications	Western Blot : 0.5-1ug/ml Immunohistochemistry (FFPE) : 2-5ug/ml Immunofluorescence : 5ug/ml
Limitations	This PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody detects progesterone receptor membrane component 1, a multifunctional membrane-associated protein involved in steroid signaling, heme binding, cell survival and metabolic regulation. PGRMC1 is a member of the membrane-associated progesterone receptor component family and contains a cytochrome b5-like heme-binding domain that supports interactions with multiple cellular pathways. Unlike classical nuclear progesterone receptors, PGRMC1 is primarily localized to intracellular membranes, including the endoplasmic reticulum, where it contributes to protein regulation, lipid metabolism and signaling responses. Its diverse biological functions have made PGRMC1 an important target for studies involving hormone response pathways, cellular metabolism and disease-associated signaling mechanisms.

PGRMC1 participates in several cellular processes, including cholesterol regulation, steroid biosynthesis, cytochrome P450 enzyme interactions and protection from cellular stress. Research has linked PGRMC1 expression to pathways controlling proliferation, apoptosis resistance, autophagy and mitochondrial function. Through its involvement in these regulatory networks, PGRMC1 influences cellular adaptation and survival under changing physiological conditions. PGRMC1 Antibody is commonly used to investigate the expression and distribution of this membrane-associated signaling protein in studies of hormone biology, intracellular communication and cell regulation.

Altered PGRMC1 expression has been studied extensively in cancer research, where it has been associated with tumor progression, cell survival, migration and therapeutic response. Elevated PGRMC1 levels have been reported in multiple cancer types, and research continues to explore its potential involvement in chemotherapy resistance, tumor metabolism and cancer cell signaling. In addition to oncology studies, PGRMC1 is investigated in reproductive biology, neurobiology and metabolic research because of its connections to steroid-related pathways and cellular homeostasis. These functions make PGRMC1 Antibody a valuable tool for examining both normal biological processes and disease-related changes.

PGRMC1 Antibody applications include analysis of progesterone receptor membrane component 1 expression, localization and regulation in research samples using techniques such as Western blot, immunohistochemistry, immunofluorescence and flow cytometry. Detection of PGRMC1 supports studies examining membrane-associated signaling, steroid pathway regulation, cancer biology and intracellular protein interactions. NSJ Bioreagents provides PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody for researchers studying hormone signaling, tumor biology and cell regulation pathways.

PGRMC1 Antibody detects a membrane-associated progesterone receptor component involved in cell survival, proliferation and therapy response, making it a useful marker for cancer signaling research featured in our Cancer Antibodies page.

Application Notes

Optimal dilution of the PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody should be determined by the researcher.

Immunogen

Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody.

Storage

After reconstitution, the PGRMC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

1. View all PGRMC1 antibodies

PGRMC1 Antibody / Progesterone Receptor Membrane Component Antibody (R31787)

Description

Application Notes

Immunogen

Storage

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents