• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> PGP9.5 Antibody / UchL1

PGP9.5 Antibody / UchL1 [clone 3E4.] (RQ6534)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6534 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human renal clear cell carcinoma tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human renal clear cell carcinoma tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human U-87 MG, 2) human SH-SY5Y, 3) rat brain and 4) mouse brain lysate with PGP9.5 antibody. Predicted molecular weight ~25 kDa.
Flow cytometry testing of human 293T cells with PGP9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP9.5 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 3E4.
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P09936
Localization Cytoplasmic, ER membrane
Applications Western Blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This PGP9.5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Application Notes

Optimal dilution of the PGP9.5 antibody should be determined by the researcher.

Immunogen

Amino acids 120-153 (ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR) were used as the immunogen for the PGP9.5 antibody.

Storage

After reconstitution, the PGP9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PGP9.5 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.