• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PGP 9.5 Antibody

PGP 9.5 Antibody (R31930)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31930 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.
›
Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.
IHC testing of FFPE human glioma tissue with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human SH-SY5Y cells with PGP 9.5 antibody (green) and DAPI nuclear stain (blue).
Flow cytometry testing of human K562 cells with PGP 9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP 9.5 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P09936
Localization Cytoplasmic, membranous
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This PGP 9.5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

UchL1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UchL1/PGP9.5 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UchL1/PGP9.5 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Application Notes

Optimal dilution of the PGP 9.5 antibody should be determined by the researcher.

Immunogen

Amino acids ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR of human PGP9.5 were used as the immunogen for the PGP 9.5 antibody.

Storage

After reconstitution, the PGP 9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PGP9.5 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.