• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Periplakin Antibody

Periplakin Antibody (R32647)

  Catalog No Formulation Size Price (USD)  
Image R32647 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC testing of FFEP human tonsil tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFEP human tonsil tissue with Periplakin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFEP human esophagus squama cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFEP human lung cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
Immunofluorescent staining of FFPE human A431 cells with Periplakin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) A549, 3) SW620, 4) HepG2, 5) SK-O-V3, 6) PANC-1, 7) SGC-7801, 8) rat lung and 9) mouse lung lysate with Periplakin antibody at 0.5ug/ml. Predicted molecular weight ~205 kDa.
Flow cytometry testing of human U-2 OS cells with Periplakin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Periplakin antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt O60437
Localization Cytoplasmic, membranous, nuclear
Applications Western Blot : 0.25-0.5ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Periplakin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Application Notes

Optimal dilution of the Periplakin antibody should be determined by the researcher.

Immunogen

Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.

Storage

After reconstitution, the Periplakin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.