• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PDK4 Antibody

PDK4 Antibody (R32250)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32250 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat skeletal muscle and 5) rat heart tissue lysate with PDK4 antibody. Expected molecular weight ~46 kDa.
Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat skeletal muscle and 5) rat heart tissue lysate with PDK4 antibody. Expected molecular weight ~46 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q16654
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Limitations This PDK4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Mouse
    Pred. Reactivity : Rat
  • Applications : WB, IHC, ELISA
    Reactivity : Human
  • Applications : WB, IHC, IF, ELISA
    Reactivity : Human
  • Applications : IF, WB, IHC, ELISA
    Reactivity : Human, Mouse

Description

Pyruvate dehydrogenase lipoamide kinase isozyme 4, mitochondrial is an enzyme that in humans is encoded by the PDK4 gene. This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. In addition, PDK4 is increased in hibernation and helps to decrease metabolism and conserve glucose by decreasing its conversion to acetyl-CoA, which enters the citric acid cycle and is converted to ATP.

Application Notes

Optimal dilution of the PDK4 antibody should be determined by the researcher.

Immunogen

Amino acids WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN of human PDK4 were used as the immunogen for the PDK4 antibody.

Storage

After reconstitution, the PDK4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PDK4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.