- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
p95 NBS1 Antibody (R31829)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R31829 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | O60934 |
| Localization | Nuclear |
| Applications | Western blot : 0.1-0.5ug/ml IHC (FFPE) : 0.5-1ug/ml ICC (FFPE) : 0.5-1ug/ml |
| Limitations | This p95 NBS1 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
p95 NBS1, also known as NBS1, NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50 (N/M/R or MRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).
Optimal dilution of the p95 NBS1 antibody should be determined by the researcher.
Amino acids RKNTELEEWLRQEMEVQNQHAKEESLADDLFR of human p95 NBS1 were used as the immunogen for the p95 NBS1 antibody.
After reconstitution, the p95 NBS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
