• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> P2RY5 Antibody / P2Y Purinoceptor 5 / LPAR6

P2RY5 Antibody / P2Y Purinoceptor 5 / LPAR6 (RQ4219)

  Catalog No Formulation Size Price (USD)  
Image RQ4219 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) MCF7, 2) HepG2 and 3) SK-OV-3 cell lysate with P2RY5 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Flow cytometry testing of human A549 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.
Flow cytometry testing of human PC-3 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.
Western blot testing of human 1) HepG2, 2) RT4, 3) HaCaT, 4) T-47D and 5) A549 cell lysate with P2RY5 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P43657
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This P2RY5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the P2RY5 antibody should be determined by the researcher.

Immunogen

Amino acids DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK were used as the immunogen for the P2RY5 antibody.

Storage

After reconstitution, the P2RY5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.