- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
P2RY5 Antibody recognizes the G protein-coupled receptor historically known as P2RY5, which is now officially designated LPAR6 (Lysophosphatidic Acid Receptor 6). Although initially classified as a purinergic receptor based on sequence similarity, subsequent research established that P2RY5 functions as a lysophosphatidic acid receptor that responds to the bioactive lipid lysophosphatidic acid rather than extracellular nucleotides. As a member of the lysophosphatidic acid receptor family, LPAR6 regulates signaling pathways involved in epithelial biology, tissue development, and cellular communication. Expression has been reported in hair follicles, skin, and numerous epithelial tissues, while altered receptor expression has also been investigated in developmental disorders and multiple forms of cancer.
Activation of P2RY5 initiates intracellular signaling through heterotrimeric G proteins, influencing cytoskeletal organization, cell adhesion, proliferation, migration, and differentiation. The receptor has received particular attention for its essential role in hair follicle development, where lysophosphatidic acid generated by the enzyme autotaxin activates signaling pathways required for normal hair shaft formation. Loss-of-function mutations in LPAR6/P2RY5 are a well-established cause of inherited woolly hair and autosomal recessive hypotrichosis. Beyond hair biology, receptor signaling contributes to epithelial homeostasis, wound repair, and maintenance of tissue architecture. Consequently, P2RY5 Antibody is widely used to investigate receptor expression, localization, and function in studies of development, skin biology, and lipid-mediated GPCR signaling.
Growing evidence also suggests that LPAR6 participates in tumor biology through regulation of cancer cell proliferation, migration, invasion, and interactions with the tumor microenvironment. Expression has been examined in hepatocellular carcinoma, breast cancer, colorectal cancer, melanoma, and other epithelial malignancies, although its biological role appears to vary depending on tissue context. These findings have generated interest in the receptor as both a potential biomarker and a therapeutic target. Because P2RY5 is an integral membrane G protein-coupled receptor, reliable antibody validation is particularly important for accurately evaluating protein expression and localization. A high-quality P2RY5 Antibody supports research investigating GPCR signaling networks, lipid-mediated signal transduction, developmental biology, and disease-associated receptor regulation.
NSJ Bioreagents provides P2RY5 Antibody products for research applications to support consistent detection of this biologically important receptor. Whether studying hair follicle development, epithelial differentiation, lipid signaling pathways, GPCR biology, inherited hypotrichosis, or cancer-associated mechanisms, a well-validated Lysophosphatidic Acid Receptor Antibody enables reliable characterization of receptor expression and localization. As research continues to uncover new functions of LPAR6/P2RY5 in normal physiology and disease, P2RY5 Antibody remains an important tool for investigating receptor biology and downstream signaling mechanisms.
Explore our complete GPCR Antibodies page to discover additional antibodies against G protein-coupled receptors involved in lipid signaling, chemokine responses, neurotransmission, sensory perception, and numerous other signaling pathways that complement P2RY5 Antibody research.
Optimal dilution of the P2RY5 Antibody / Lysophosphatidic Acid Receptor Antibody should be determined by the researcher.
Amino acids DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK were used as the immunogen for the P2RY5 antibody.
After reconstitution, the P2RY5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
P2RY5 antibody, LPAR6 antibody, Lysophosphatidic Acid Receptor antibody, Lysophosphatidic Acid Receptor 6 antibody, GPR87B antibody, Hair Growth Receptor antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.